HPA003300

ASB7 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003300
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003300, RRID:AB_1845071
Product name
Anti-ASB7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003300
Antibody type
Polyclonal
Antigen
Ankyrin repeat and SOCS box protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQG
YSPNGRDANGWTLLHFSAARGKERCVRVFLEHGAD
PTVKDLIGGFTALHYAAMHGRARIARLMLESEYRS
DIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAE
VDPLSDK
Storage
-20C
Provider Type Product Number
- No reagents -