HPA026540

SLC20A2 antibody from Atlas Antibodies
Glvr-2, GLVR2, MLVAR, PiT-2, Ram-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026540
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026540, RRID:AB_1855408
Product name
Anti-SLC20A2
Provider product page
Atlas Antibodies - HPA026540
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVG
DTVSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVE
MKLASELADPDQPREDPAEEEKEEKDAPE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -