HPA026540

SLC20A2 antibody from Sigma-Aldrich
Glvr-2, GLVR2, MLVAR, PiT-2, Ram-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026540
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026540, RRID:AB_1855408
Product name
Anti-SLC20A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026540
Antibody type
Polyclonal
Antigen
Sodium-dependent phosphate transporter 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVG
DTVSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVE
MKLASELADPDQPREDPAEEEKEEKDAPE
Storage
-20C
Provider Type Product Number
- No reagents -