HPA018526

SERINC4 antibody from MilliporeSigma / Merck KGaA
FLJ40363
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018526
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018526, RRID:AB_2185280
Product name
Anti-SERINC4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018526
Antibody type
Polyclonal
Antigen
Serine incorporator 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EASYLAEVFGPLWIVKVYSYEFQKPSLCFCCPETV
EADKGQRGGAARPADQETPPAPPVQVQHLSYNYS
Storage
-20C
Provider Type Product Number
- No reagents -