Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007327-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007327-M01, RRID:AB_489844
- Product name
- UBE2G2 monoclonal antibody (M01), clone 5E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UBE2G2.
- Antigen sequence
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFF
EWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPK
MRFTCEMFHPNIYPDGR- Isotype
- IgG
- Antibody clone number
- 5E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ataxin-3 deubiquitination is coupled to Parkin ubiquitination via E2 ubiquitin-conjugating enzyme.
Durcan TM, Kontogiannea M, Bedard N, Wing SS, Fon EA
The Journal of biological chemistry 2012 Jan 2;287(1):531-41
The Journal of biological chemistry 2012 Jan 2;287(1):531-41
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- UBE2G2 monoclonal antibody (M01), clone 5E1 Western Blot analysis of UBE2G2 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of UBE2G2 expression in transfected 293T cell line by UBE2G2 monoclonal antibody (M01), clone 5E1.Lane 1: UBE2G2 transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged UBE2G2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to UBE2G2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
