HPA003332

UBE2G2 antibody from Sigma-Aldrich
UBC7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003332
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003332, RRID:AB_1858525
Product name
Anti-UBE2G2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003332
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 G2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISI
LHAPGDDPMGYESSAERWSPVQSVEKILLSVVSML
AEPNDESGANVDASKMWRDDREQFYKIAKQIVQKS
Storage
-20C
Provider Type Product Number
- No reagents -