HPA003302

UBE2H antibody from Sigma-Aldrich
GID3, UBC8, UBCH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003302
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003302, RRID:AB_1858526
Product name
Anti-UBE2H antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003302
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 H recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPS
IGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLT
NIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEY
KQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSD
FSEDEAQD
Storage
-20C
Provider Type Product Number
- No reagents -