Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183890 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Arginine Methyltransferase 5 (PRMT5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRMT5 antibody: synthetic peptide directed towards the N terminal of human PRMT5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLL
LSGRD WNTLIVGKLS- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Toward an assembly line for U7 snRNPs: interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes.
Azzouz TN, Pillai RS, Däpp C, Chari A, Meister G, Kambach C, Fischer U, Schümperli D
The Journal of biological chemistry 2005 Oct 14;280(41):34435-40
The Journal of biological chemistry 2005 Oct 14;280(41):34435-40
No comments: Submit comment
No validations: Submit validation data