HPA005525

PRMT5 antibody from Atlas Antibodies
HRMT1L5, SKB1, SKB1Hs
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005525
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005525, RRID:AB_1079679
Product name
Anti-PRMT5
Provider product page
Atlas Antibodies - HPA005525
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAA
KQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVT
VVSSDMREWVAPEKADIIVSELLGSFADNELSPEC
LDGAQHF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -