HPA005525

PRMT5 antibody from Sigma-Aldrich
HRMT1L5, SKB1, SKB1Hs
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005525
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005525, RRID:AB_1079679
Product name
Anti-PRMT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005525
Antibody type
Polyclonal
Antigen
Protein arginine N-methyltransferase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAA
KQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVT
VVSSDMREWVAPEKADIIVSELLGSFADNELSPEC
LDGAQHF
Storage
-20C
Provider Type Product Number
- No reagents -