HPA003303

UBE2E3 antibody from Sigma-Aldrich
UbcH9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003303
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003303, RRID:AB_1858521
Product name
Anti-UBE2E3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003303
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 E3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQE
ERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELA
EITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYE
GGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQ
GV
Storage
-20C
Provider Type Product Number
- No reagents -