HPA011742

USP6 antibody from Sigma-Aldrich
HRP1, Tre-2, TRE17, Tre2, TRESMCR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011742
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011742, RRID:AB_1858699
Product name
Anti-USP6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011742
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAIS
QEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSS
KIDRQKVPTEKGATGLSNLGNT
Storage
-20C
Provider Type Product Number
- No reagents -