Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182924 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ubiquitin-Conjugating Enzyme E2N (UBE2N) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UBE2N antibody: synthetic peptide directed towards the middle region of human UBE2N
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSA
PNPDD PLANDVAEQW- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Quantitative analysis of the secretome of TGF-beta signaling-deficient mammary fibroblasts.
The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains.
Xu BJ, Yan W, Jovanovic B, An AQ, Cheng N, Aakre ME, Yi Y, Eng J, Link AJ, Moses HL
Proteomics 2010 Jul;10(13):2458-70
Proteomics 2010 Jul;10(13):2458-70
The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains.
Bothos J, Summers MK, Venere M, Scolnick DM, Halazonetis TD
Oncogene 2003 Oct 16;22(46):7101-7
Oncogene 2003 Oct 16;22(46):7101-7
No comments: Submit comment
No validations: Submit validation data