HPA003962

UBE2N antibody from Sigma-Aldrich
MGC8489, UBC13, UbcH-ben
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003962
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003962, RRID:AB_1858545
Product name
Anti-UBE2N antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003962
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 N recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDS
PFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNV
DKLGRIC
Storage
-20C
Provider Type Product Number
- No reagents -