HPA020344

CWC27 antibody from Atlas Antibodies
NY-CO-10, SDCCAG-10, SDCCAG10
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA020344
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020344, RRID:AB_1856644
Product name
Anti-CWC27
Provider product page
Atlas Antibodies - HPA020344
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
REDQTLALLNQFKSKLTQAIAETPENDIPETEVED
DEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDPR
NPVNKRRREESK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -