HPA020344

CWC27 antibody from Sigma-Aldrich
NY-CO-10, SDCCAG-10, SDCCAG10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020344
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020344, RRID:AB_1856644
Product name
Anti-SDCCAG10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020344
Antibody type
Polyclonal
Antigen
Peptidyl-prolyl cis-trans isomerase SDCCAG10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REDQTLALLNQFKSKLTQAIAETPENDIPETEVED
DEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDPR
NPVNKRRREESK
Storage
-20C
Provider Type Product Number
- No reagents -