HPA024493

UNC13B antibody from Atlas Antibodies
hmunc13, Munc13-2, UNC13, Unc13h2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024493
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024493, RRID:AB_1858618
Product name
Anti-UNC13B
Provider product page
Atlas Antibodies - HPA024493
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SQLSELDQYHEQDDDHRETDSIHSCHSSHSLSRDG
QAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTH
PP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -