HPA024493

UNC13B antibody from Sigma-Aldrich
hmunc13, Munc13-2, UNC13, Unc13h2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024493
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024493, RRID:AB_1858618
Product name
Anti-UNC13B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024493
Antibody type
Polyclonal
Antigen
Protein unc-13 homolog B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQLSELDQYHEQDDDHRETDSIHSCHSSHSLSRDG
QAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTH
PP
Storage
-20C
Provider Type Product Number
- No reagents -