HPA013207

UBE2G1 antibody from Sigma-Aldrich
UBC7, UBE2G
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013207
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013207, RRID:AB_1858524
Product name
Anti-UBE2G1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013207
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 G1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAVKRAEASGLAPAARRRSRRLSPAFLGSGAPVAG
PGFLGTPRSSRPQSLSPALRKPRRQPGPSAGRMTE
LQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRW
EVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMK
FITEIWHPNV
Storage
-20C
Provider Type Product Number
- No reagents -