HPA016565

FEM1A antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016565
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016565, RRID:AB_1848489
Product name
Anti-FEM1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016565
Antibody type
Polyclonal
Antigen
Protein fem-1 homolog A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSYVLQDRAAKGSLGTQIGFADLMGVLTKGVREVE
RALQLPREPGDSAQFTKALAIILHLLYLLEKVECT
PSQEHLKHQTVY
Storage
-20C
Provider Type Product Number
- No reagents -