Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB21170 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB21170, RRID:AB_10964153
- Product name
- SLC38A6 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SLC38A6.
- Antigen sequence
KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSK
ESA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney with SLC38A6 polyclonal antibody (Cat # PAB21170) shows moderate positivity in cytoplasm and membranes at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)