HPA018508

SLC38A6 antibody from Sigma-Aldrich
NAT-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018508
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018508, RRID:AB_2190518
Product name
Anti-SLC38A6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018508
Antibody type
Polyclonal
Antigen
Probable sodium-coupled neutral amino acid transporter 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSK
ESA
Storage
-20C
Provider Type Product Number
- No reagents -