HPA018508

SLC38A6 antibody from Atlas Antibodies
NAT-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018508
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018508, RRID:AB_2190518
Product name
Anti-SLC38A6
Provider product page
Atlas Antibodies - HPA018508
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSK
ESA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -