HPA021297

RUSC2 antibody from Sigma-Aldrich
KIAA0375
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021297
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021297, RRID:AB_1856510
Product name
Anti-RUSC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021297
Antibody type
Polyclonal
Antigen
Iporin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPSPFESKMSYESHHPESGGREGGYGCPHASSPEL
DANCNSYRPHCEPCPAVADLTACFQSQARLVVATQ
NYYKLVTCDLSSQSSPSPAGSSITSCSEEHTKISP
Storage
-20C
Provider Type Product Number
- No reagents -