HPA005482

IL17RB antibody from Sigma-Aldrich
CRL4, EVI27, IL17BR, IL17RH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005482
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005482, RRID:AB_1851656
Product name
Anti-IL17RB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005482
Antibody type
Polyclonal
Antigen
Interleukin-17 receptor B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSV
ATGDYSILMNVSWVLRADASIRLLKATKICVTGKS
NFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFP
VELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG
Storage
-20C
Provider Type Product Number
- No reagents -