HPA014946

TMEM41B antibody from Atlas Antibodies
KIAA0033
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014946
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014946, RRID:AB_2205037
Product name
Anti-TMEM41B
Provider product page
Atlas Antibodies - HPA014946
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGS
RDHQKEKSWVEAGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -