ABIN567540

AIMP2 antibody from antibodies-online
JTV-1, JTV1, p38, PRO0992

Antibody data

Product number
ABIN567540
Provider
antibodies-online
Product name
anti-Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 2 (AIMP2) (N-Term) antibody
Provider product page
antibodies-online - ABIN567540
Antibody type
Polyclonal
Antigen
The immunogen for anti-AIMP2 antibody: synthetic peptide directed towards the N terminal of human AIMP2
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
SLQALESRQDDILKRLYELKAAVDGLSKMIQTPDA
DLDVT NIIQADEPTT
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -