HPA019098

AIMP2 antibody from Sigma-Aldrich
JTV-1, JTV1, p38, PRO0992
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019098
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019098, RRID:AB_1852040
Product name
Anti-JTV1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019098
Antibody type
Polyclonal
Antigen
Multisynthetase complex auxiliary component p38 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEES
NLSLQALESRQDDILKRLYELKAAVDGLSKMIQTP
DADLDVTNIIQADEPTTLTTNAL
Storage
-20C
Provider Type Product Number
- No reagents -