Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010527-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010527-M07, RRID:AB_1679207
- Product name
- IPO7 monoclonal antibody (M07), clone 4G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IPO7.
- Antigen sequence
DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGL
NEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKF
SAPVVPSSFNFGGPAPGMN- Isotype
- IgG
- Antibody clone number
- 4G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nuclear extracellular signal-regulated kinase 1 and 2 translocation is mediated by casein kinase 2 and accelerated by autophosphorylation.
Plotnikov A, Chuderland D, Karamansha Y, Livnah O, Seger R
Molecular and cellular biology 2011 Sep;31(17):3515-30
Molecular and cellular biology 2011 Sep;31(17):3515-30
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IPO7 monoclonal antibody (M07), clone 4G6. Western Blot analysis of IPO7 expression in HeLa(Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IPO7 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol