HPA010569

TNFRSF17 antibody from Sigma-Aldrich
BCM, BCMA, CD269, TNFRSF13A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010569
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010569, RRID:AB_10602482
Product name
Anti-TNFRSF17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010569
Antibody type
Polyclonal
Antigen
tumor necrosis factor receptor superfamily, member 17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGD
EIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPL
PAMEEGATILVTTKTNDYCKSLPAALSATEIEKSI
SAR
Storage
-20C
Provider Type Product Number
- No reagents -