Antibody data

Product number
H00001687-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001687-B02, RRID:AB_1573853
Product name
DFNA5 MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00001687-B02
Antibody type
Polyclonal
Antigen
DFNA5 (NP_004394.1, 1 a.a. ~ 496 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLS
LVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSP
VVVESDFVKYEGKFANHVSGTLETALGKVKLNLGG
SSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLR
NPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQ
VEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLE
IPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFE
NKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDG
PLSVLKQATLLLERNFHPFAELPEPQQTALSDIFQ
AVLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKP
RQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMT
AYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLL
RALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASA
DISLERLKSSVKAVILKDSKVFPLLLCITLNGLCA
LGREHS
Vial size
50 µl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -