Antibody data

Product number
H00001687-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001687-B01, RRID:AB_1573852
Product name
DFNA5 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00001687-B01
Antibody type
Polyclonal
Antigen
DFNA5 (-, 1 a.a. ~ 295 a.a) full-length human protein.
Description
Mouse polyclonal antibody raised against a full-length human DFNA5 protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDG
NVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEF
CLLRGKQGGFENKKRIDPVYLDPLVFREFAFIDMP
DAAHGISSQDGPLSVLKQATLLLERNFHPFAELPE
PQQTALSDIFQAVLFDDELLMVLEPVCDDLVSGLS
PTVAVLGELKPRQQQDLVAFLQLVGCSLQGGCPGP
EDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCK
LQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTER
FGIVQRLFASADISL
Vial size
50 μL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -