HPA011326

GSDME antibody from Atlas Antibodies
DFNA5, ICERE-1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA011326
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011326, RRID:AB_1847629
Product name
Anti-DFNA5
Provider product page
Atlas Antibodies - HPA011326
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPR
QQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTA
YFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLLR
ALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASAD
ISLERLKSSV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -