ABIN630421

antibody from antibodies-online

Targeting: TGFBR2 MFS2, TBR-ii, TBRII

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630421 - Provider product page
Provider: antibodies-online
Product name: anti-Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2) antibody
Antibody type: Polyclonal
Antigen: TGFBR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

TGFBR2 protein structure - ABIN630421 shown in red.