HPA018904

SPEG antibody from Sigma-Aldrich
APEG1, BPEG, KIAA1297, MGC12676, MYLK6, SPEGalpha, SPEGbeta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018904
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018904, RRID:AB_1844924
Product name
Anti-SPEG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018904
Antibody type
Polyclonal
Antigen
Striated muscle preferentially expressed protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQV
VAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV
Storage
-20C
Provider Type Product Number
- No reagents -