HPA019353

PPWD1 antibody from MilliporeSigma / Merck KGaA
KIAA0073
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019353
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019353, RRID:AB_1855668
Product name
Anti-PPWD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019353
Antibody type
Polyclonal
Antigen
Peptidylprolyl isomerase domain and WD repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVE
NFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTG
Storage
-20C
Provider Type Product Number
- No reagents -