Antibody data

Product number
HPA003750
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003750, RRID:AB_1856383
Product name
Anti-RNGTT
Provider product page
Atlas Antibodies - HPA003750
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDR
DNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR
VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIE
REIISPRHEKMKTGLIDKTQEP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.