HPA003750

RNGTT antibody from Sigma-Aldrich
hCAP, HCE, HCE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003750
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003750, RRID:AB_1856383
Product name
Anti-RNGTT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003750
Antibody type
Polyclonal
Antigen
mRNA-capping enzyme recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDR
DNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR
VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIE
REIISPRHEKMKTGLIDKTQEP
Storage
-20C
Provider Type Product Number
- No reagents -