Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000373-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000373-M01, RRID:AB_1137511
- Product name
- TRIM23 monoclonal antibody (M01), clone 2H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIM23.
- Antigen sequence
MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCE
DVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAI
RCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNG
PIGQY- Isotype
- IgG
- Antibody clone number
- 2H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The interferon signaling antagonist function of yellow fever virus NS5 protein is activated by type I interferon.
Polyubiquitin conjugation to NEMO by triparite motif protein 23 (TRIM23) is critical in antiviral defense.
Laurent-Rolle M, Morrison J, Rajsbaum R, Macleod JM, Pisanelli G, Pham A, Ayllon J, Miorin L, Martínez-Romero C, tenOever BR, García-Sastre A
Cell host & microbe 2014 Sep 10;16(3):314-27
Cell host & microbe 2014 Sep 10;16(3):314-27
Polyubiquitin conjugation to NEMO by triparite motif protein 23 (TRIM23) is critical in antiviral defense.
Arimoto K, Funami K, Saeki Y, Tanaka K, Okawa K, Takeuchi O, Akira S, Murakami Y, Shimotohno K
Proceedings of the National Academy of Sciences of the United States of America 2010 Sep 7;107(36):15856-61
Proceedings of the National Academy of Sciences of the United States of America 2010 Sep 7;107(36):15856-61
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRIM23 monoclonal antibody (M01), clone 2H4. Western Blot analysis of TRIM23 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TRIM23 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol