Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502915 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ADP-Ribosylation Factor 1 (ARF1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDK
LGLHS LRHRNWYIQA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of a neuron-specific human gene, KIAA1110, that is a guanine nucleotide exchange factor for ARF1.
Hattori Y, Ohta S, Hamada K, Yamada-Okabe H, Kanemura Y, Matsuzaki Y, Okano H, Kawakami Y, Toda M
Biochemical and biophysical research communications 2007 Dec 28;364(4):737-42
Biochemical and biophysical research communications 2007 Dec 28;364(4):737-42
No comments: Submit comment
No validations: Submit validation data