AV100885

SNAPC1 antibody from MilliporeSigma / Merck KGaA
PTFgamma, SNAP43
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV100885
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-SNAPC1 (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV100885
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SNAPC1 with an internal ID of P01968
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
KMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENES
LSGTEFTASKKRRKH
Storage
-20C