Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184327 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Small Nuclear RNA Activating Complex, Polypeptide 1, 43kDa (SNAPC1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SNAPC1 antibody: synthetic peptide directed towards the C terminal of human SNAPC1
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
- KMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENES
 LSGTE FTASKKRRKH
- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references		Cooperation between small nuclear RNA-activating protein complex (SNAPC) and TATA-box-binding protein antagonizes protein kinase CK2 inhibition of DNA binding by SNAPC.
				
		
	
			Gu L, Esselman WJ, Henry RW
The Journal of biological chemistry 2005 Jul 29;280(30):27697-704
		The Journal of biological chemistry 2005 Jul 29;280(30):27697-704
				No comments: Submit comment	
	
			
			No validations: Submit validation data