ABIN184327

SNAPC1 antibody from antibodies-online
PTFgamma, SNAP43
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN184327
Provider
antibodies-online
Product name
anti-Small Nuclear RNA Activating Complex, Polypeptide 1, 43kDa (SNAPC1) antibody
Provider product page
antibodies-online - ABIN184327
Antibody type
Polyclonal
Antigen
The immunogen for anti-SNAPC1 antibody: synthetic peptide directed towards the C terminal of human SNAPC1
Description
Protein A purified
Reactivity
Human
Host
Rabbit
Antigen sequence
KMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENES
LSGTE FTASKKRRKH
Vial size
0.1 mg
Storage
Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C