AV38227

SNAPC1 antibody from MilliporeSigma / Merck KGaA
PTFgamma, SNAP43
No application information provided.

Antibody data

Product number
AV38227
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-SNAPC1 (AB2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV38227
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SNAPC1 with an internal ID of S05011
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
DSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSL
RNKGNVQNIHKEDKP
Storage
-20C