HPA003223

KREMEN2 antibody from Sigma-Aldrich
KRM2, MGC10791
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003223
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003223, RRID:AB_1079217
Product name
Anti-KREMEN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003223
Antibody type
Polyclonal
Antigen
Kremen protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSS
ASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEG
IYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGT
STKLTVQV
Storage
-20C
Provider Type Product Number
- No reagents -