Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183181 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNH5 antibody: synthetic peptide directed towards the N terminal of human KCNH5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSD
ILPQY KQEAPKTPPH- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular identification and characterisation of the human eag2 potassium channel.
On the metabolic function of glutamate dehydrogenase in rat liver.
Ju M, Wray D
FEBS letters 2002 Jul 31;524(1-3):204-10
FEBS letters 2002 Jul 31;524(1-3):204-10
On the metabolic function of glutamate dehydrogenase in rat liver.
McGivan JD, Chappell JB
FEBS letters 1975 Mar 15;52(1):1-7
FEBS letters 1975 Mar 15;52(1):1-7
No comments: Submit comment
No validations: Submit validation data