HPA040412

SPG11 antibody from Atlas Antibodies
ALS5, FLJ21439, KIAA1840
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA040412
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040412, RRID:AB_10795418
Product name
Anti-SPG11
Provider product page
Atlas Antibodies - HPA040412
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IKFPWKLTDAIDEYDVHENVPKVKESNIWKKLSFE
EVIASAILNNKIPEAQTFFRIDSHSAQKLEELIGI
GLNLVFDNLKKNNIKEASELLKNMGFDVKGQLLKI
CFYTT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -