HPA025696

PCMTD1 antibody from MilliporeSigma / Merck KGaA
FLJ10883
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025696
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA025696, RRID:AB_1855077
Product name
Anti-PCMTD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA025696
Antibody type
Polyclonal
Antigen
Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVGNQLIPQPLDSEEDEKMEEDNKEEEEKDHNEAM
KPEEPPQNLLREKIMKLPLPE
Storage
-20C
Provider Type Product Number
- No reagents -