HPA002932

TIMM9 antibody from Sigma-Aldrich
TIM9A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002932
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002932, RRID:AB_1080287
Product name
Anti-TIMM9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002932
Antibody type
Polyclonal
Antigen
Mitochondrial import inner membrane translocase subunit Tim9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDF
TTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYH
IQQNEALAAKAGLLGQPR
Storage
-20C
Provider Type Product Number
- No reagents -