Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010752-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010752-A01, RRID:AB_463544
- Product name
- CHL1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CHL1.
- Antigen sequence
EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAK
GNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIP
NEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSV
PKFPK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CHL1 negatively regulates the proliferation and neuronal differentiation of neural progenitor cells through activation of the ERK1/2 MAPK pathway.
Neural recognition molecules CHL1 and NB-3 regulate apical dendrite orientation in the neocortex via PTP alpha.
Huang X, Zhu LL, Zhao T, Wu LY, Wu KW, Schachner M, Xiao ZC, Fan M
Molecular and cellular neurosciences 2011 Jan;46(1):296-307
Molecular and cellular neurosciences 2011 Jan;46(1):296-307
Neural recognition molecules CHL1 and NB-3 regulate apical dendrite orientation in the neocortex via PTP alpha.
Ye H, Tan YL, Ponniah S, Takeda Y, Wang SQ, Schachner M, Watanabe K, Pallen CJ, Xiao ZC
The EMBO journal 2008 Jan 9;27(1):188-200
The EMBO journal 2008 Jan 9;27(1):188-200
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CHL1 polyclonal antibody (A01), Lot # SAC4060428QCS1 Western Blot analysis of CHL1 expression in Jurkat ( Cat # L017V1 ).