HPA003345

CHL1 antibody from Sigma-Aldrich
CALL, FLJ44930, L1CAM2, MGC132578
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003345
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003345, RRID:AB_1078516
Product name
Anti-CHL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003345
Antibody type
Polyclonal
Antigen
Neural cell adhesion molecule L1-like protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGTL
QINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNA
TKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLK
LSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLE
DQGIYCCS
Storage
-20C
Provider Type Product Number
- No reagents -